Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMCO1 Rabbit Polyclonal Antibody (HRP)

TMCO1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

PCIA3, TMCC4, HP10122, PNAS-136

UniProt

Q9UM00

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human TMCO1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: CSFIFLYILCTMSIRQNIQKILGLAPSRAATKQAGGFLGPPPPSGKFS

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

21kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_061899

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Nprl3 activation kit by CRISPRa
GA202573 1 Kit

Mouse Nprl3 activation kit by CRISPRa

Sign In for Pricing
View Details
APC Anti-Mouse CD66A Antibody[Mab-CC1]
AN00328E-01 50 Tests

APC Anti-Mouse CD66A Antibody[Mab-CC1]

Sign In for Pricing
View Details
APC Anti-Mouse CD66A Antibody[Mab-CC1]
AN00328E-02 100 Tests

APC Anti-Mouse CD66A Antibody[Mab-CC1]

Sign In for Pricing
View Details
APC Anti-Mouse CD66A Antibody[Mab-CC1]
AN00328E-03 2x 100 Tests

APC Anti-Mouse CD66A Antibody[Mab-CC1]

Sign In for Pricing
View Details
Glycylglycyl-L-tyrosine TFA Salt
TRC-G718610-25MG 25 mg

Glycylglycyl-L-tyrosine TFA Salt

Sign In for Pricing
View Details
CNTN3 Polyclonal Antibody
E-AB-90947-01 60 µL

CNTN3 Polyclonal Antibody

Sign In for Pricing
View Details