Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NDUFB11 Rabbit Polyclonal Antibody (FITC)

NDUFB11 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

ESSS, Np15, P17.3, NP17.3, CI-ESSS, MC1DN30

UniProt

Q9NX14

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human NDUFB11

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: PSAVAGKRPPEPTTPWQEDPEPEDENLYEKNPDSHGYDKDPVLDVWNMRL

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

16kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DNAAF10 Mouse Monoclonal Antibody [Clone ID: OTI5H5]
CF809528 100 µg

DNAAF10 Mouse Monoclonal Antibody [Clone ID: OTI5H5]

Sign In for Pricing
View Details
MARVELD2 (NM_001038603) Human Over-expression Lysate
LC422002 20 µg

MARVELD2 (NM_001038603) Human Over-expression Lysate

Sign In for Pricing
View Details
3,4-Di-O-benzyl Droxidopa-13C2,15N Hydrochloride(Mixture of Diastereomers)
TRC-D417527-25MG 25 mg

3,4-Di-O-benzyl Droxidopa-13C2,15N Hydrochloride(Mixture of Diastereomers)

Sign In for Pricing
View Details
CPXM (CPXM1) (NM_001184699) Human Over-expression Lysate
LC433406 20 µg

CPXM (CPXM1) (NM_001184699) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant MCM2 (phospho S108) Antibody
RC-5364-01 50 μL

Recombinant MCM2 (phospho S108) Antibody

Sign In for Pricing
View Details
Recombinant MCM2 (phospho S108) Antibody
RC-5364-02 100 µL

Recombinant MCM2 (phospho S108) Antibody

Sign In for Pricing
View Details