Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DLL4 Rabbit Polyclonal Antibody (FITC)

DLL4 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

AOS6, delta4, hdelta2

UniProt

Q9NR61

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human DLL4

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: QGSLAVGQNWLLDEQTSTLTRLRYSYRVICSDNYYGDNCSRLCKKRNDHF

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

72kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast

Tested Applications

WB

NCBI Accession Number

NP_061947

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SYNE2 (Synaptic Nuclear Envelope Protein 2, Syne-2, Nesprin-2, Nesp2, Nuclear Envelope Spectrin Repeat Protein 2, Nucleus and Actin Connecting Element Protein, Protein NUANCE, NUA, EDMD5, KIAA1011, TROPH) (MaxLight 490)
134135-ML490 100 µL

SYNE2 (Synaptic Nuclear Envelope Protein 2, Syne-2, Nesprin-2, Nesp2, Nuclear Envelope Spectrin Repeat Protein 2, Nucleus and Actin Connecting Element Protein, Protein NUANCE, NUA, EDMD5, KIAA1011, TROPH) (MaxLight 490)

Sign In for Pricing
View Details
DDX39A antibody
orb618731 100 µL

DDX39A antibody

Sign In for Pricing
View Details
Influenza A H1N1 (A/Tawain/01/1986) Hemagglutinin/HA HEK293 Cell Lysate (WB positive control)
MBS8116242-01 0.3 mg

Influenza A H1N1 (A/Tawain/01/1986) Hemagglutinin/HA HEK293 Cell Lysate (WB positive control)

Sign In for Pricing
View Details
Influenza A H1N1 (A/Tawain/01/1986) Hemagglutinin/HA HEK293 Cell Lysate (WB positive control)
MBS8116242-02 5x 0.3 mg

Influenza A H1N1 (A/Tawain/01/1986) Hemagglutinin/HA HEK293 Cell Lysate (WB positive control)

Sign In for Pricing
View Details
Recombinant Vibrio cholerae serotype O1 Nucleoside diphosphate kinase (ndk)
MBS1406122-01 0.02 mg (E-Coli)

Recombinant Vibrio cholerae serotype O1 Nucleoside diphosphate kinase (ndk)

Sign In for Pricing
View Details
Recombinant Vibrio cholerae serotype O1 Nucleoside diphosphate kinase (ndk)
MBS1406122-02 0.1 mg (E-Coli)

Recombinant Vibrio cholerae serotype O1 Nucleoside diphosphate kinase (ndk)

Sign In for Pricing
View Details