Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DLL4 Rabbit Polyclonal Antibody (HRP)

DLL4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

AOS6, delta4, hdelta2

UniProt

Q9NR61

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human DLL4

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: QGSLAVGQNWLLDEQTSTLTRLRYSYRVICSDNYYGDNCSRLCKKRNDHF

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

72kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast

Tested Applications

WB

NCBI Accession Number

NP_061947

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pemetrexed disodium 100mg
A10707-100 100 mg

Pemetrexed disodium 100mg

Sign In for Pricing
View Details
Phospho-ERK1/2 (Thr202 + Tyr204) Polyclonal Antibody, Cy7 Conjugated
bs-3016R-Cy7-TR 20 µL

Phospho-ERK1/2 (Thr202 + Tyr204) Polyclonal Antibody, Cy7 Conjugated

Sign In for Pricing
View Details
SHBG Antibody [TTEB3]
33-984 100 µg

SHBG Antibody [TTEB3]

Sign In for Pricing
View Details
Rat Suppression of Tumorigenicity 14 ELISA Kit
MBS101712-01 48 Well

Rat Suppression of Tumorigenicity 14 ELISA Kit

Sign In for Pricing
View Details
Rat Suppression of Tumorigenicity 14 ELISA Kit
MBS101712-02 96 Well

Rat Suppression of Tumorigenicity 14 ELISA Kit

Sign In for Pricing
View Details
Rat Suppression of Tumorigenicity 14 ELISA Kit
MBS101712-03 5x 96 Well

Rat Suppression of Tumorigenicity 14 ELISA Kit

Sign In for Pricing
View Details