Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ndfip2 Rabbit Polyclonal Antibody (FITC)

Ndfip2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Ndfip2

UniProt

F1M5D2

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Rat

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: YSSITVDGPTTSDADVYSEFYPVPPPYSVATSLPTYDEAEKAKAAALAAA

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

27kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

EDM02480

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD44V6 (HCAM, Homing Cell Adhesion Molecule, Pgp-1, Phagocytic Glycoprotein-1, Hermes Antigen, Lymphocyte Homing Receptor, ECM-III, HUTCH-1) (MaxLight 750) discontinued
C2398-88-ML750 100 µL

CD44V6 (HCAM, Homing Cell Adhesion Molecule, Pgp-1, Phagocytic Glycoprotein-1, Hermes Antigen, Lymphocyte Homing Receptor, ECM-III, HUTCH-1) (MaxLight 750) discontinued

Sign In for Pricing
View Details
H2BFS
CSB-CL010104HU2 10 μg Plasmid + 200 μL Glycerol

H2BFS

Sign In for Pricing
View Details
AP1S3, NT (AP1S3, AP-1 complex subunit sigma-3, Adapter-related protein complex 1 sigma-1C subunit, Adaptor protein complex AP-1 sigma-1C subunit, Clathrin assembly protein complex 1 sigma-1C small chain, Golgi adaptor HA1/AP1 adaptin sigma-1C subunit, Sigma 1C subunit of AP-1 clathrin, Sigma-adaptin 1C, Sigma1C-adaptin) (MaxLight 405) discontinued
031940-ML405 100 µL

AP1S3, NT (AP1S3, AP-1 complex subunit sigma-3, Adapter-related protein complex 1 sigma-1C subunit, Adaptor protein complex AP-1 sigma-1C subunit, Clathrin assembly protein complex 1 sigma-1C small chain, Golgi adaptor HA1/AP1 adaptin sigma-1C subunit, Sigma 1C subunit of AP-1 clathrin, Sigma-adaptin 1C, Sigma1C-adaptin) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Recombinant Human CD258 protein
TD-ATMP00420HU 50 µg

Recombinant Human CD258 protein

Sign In for Pricing
View Details
1- (2,4-Difluorophenyl) -3- (furan-2-yl) -1H-pyrazol-5-amine
BMB18879-01 50 mg

1- (2,4-Difluorophenyl) -3- (furan-2-yl) -1H-pyrazol-5-amine

Sign In for Pricing
View Details
1- (2,4-Difluorophenyl) -3- (furan-2-yl) -1H-pyrazol-5-amine
BMB18879-02 0.5 g

1- (2,4-Difluorophenyl) -3- (furan-2-yl) -1H-pyrazol-5-amine

Sign In for Pricing
View Details