Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ndfip2 Rabbit Polyclonal Antibody (HRP)

Ndfip2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Ndfip2

UniProt

F1M5D2

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Rat

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: YSSITVDGPTTSDADVYSEFYPVPPPYSVATSLPTYDEAEKAKAAALAAA

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

27kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

EDM02480

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NIPA2 Human Pre-designed siRNA Set A
HY-RS09303 1 Set

NIPA2 Human Pre-designed siRNA Set A

Sign In for Pricing
View Details
NOS3 (Nitric oxide synthase, endothelial, Constitutive NOS, cNOS, EC-NOS, Endothelial NOS, eNOS, NOS type III, NOSIII)
326155-01 50 µg

NOS3 (Nitric oxide synthase, endothelial, Constitutive NOS, cNOS, EC-NOS, Endothelial NOS, eNOS, NOS type III, NOSIII)

Sign In for Pricing
View Details
NOS3 (Nitric oxide synthase, endothelial, Constitutive NOS, cNOS, EC-NOS, Endothelial NOS, eNOS, NOS type III, NOSIII)
326155-02 100 µg

NOS3 (Nitric oxide synthase, endothelial, Constitutive NOS, cNOS, EC-NOS, Endothelial NOS, eNOS, NOS type III, NOSIII)

Sign In for Pricing
View Details
Recombinant Nepenthes distillatoria Aspartic proteinase nepenthesin-1 (X20S, X45S, X48S, X51S, X53S, X98S, X107S), partial
CSB-EP302470NCC-01 10 µg

Recombinant Nepenthes distillatoria Aspartic proteinase nepenthesin-1 (X20S, X45S, X48S, X51S, X53S, X98S, X107S), partial

Sign In for Pricing
View Details
Recombinant Nepenthes distillatoria Aspartic proteinase nepenthesin-1 (X20S, X45S, X48S, X51S, X53S, X98S, X107S), partial
CSB-EP302470NCC-02 50 µg

Recombinant Nepenthes distillatoria Aspartic proteinase nepenthesin-1 (X20S, X45S, X48S, X51S, X53S, X98S, X107S), partial

Sign In for Pricing
View Details
Recombinant Nepenthes distillatoria Aspartic proteinase nepenthesin-1 (X20S, X45S, X48S, X51S, X53S, X98S, X107S), partial
CSB-EP302470NCC-03 200 µg

Recombinant Nepenthes distillatoria Aspartic proteinase nepenthesin-1 (X20S, X45S, X48S, X51S, X53S, X98S, X107S), partial

Sign In for Pricing
View Details