Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FLJ20674 Rabbit Polyclonal Antibody (FITC)

FLJ20674 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

FLJ20674, MGC1013

UniProt

Q8N0Z9

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human FLJ20674

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: LNVTQWFQVWLQVASGPYQIEVHIVATGTLPNGTLYAARGSQVDFSCNSS

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

59kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_061959

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Primpol Mouse shRNA Plasmid (Locus ID 408022)
TL510295 1 Kit

Primpol Mouse shRNA Plasmid (Locus ID 408022)

Sign In for Pricing
View Details
Lentiviral human PRAMEF2 sgRNA gene knockout kit - Lentiviral human PRAMEF2 sgRNA gene knockout kit (100)
GTR15363052 1 Vial

Lentiviral human PRAMEF2 sgRNA gene knockout kit - Lentiviral human PRAMEF2 sgRNA gene knockout kit (100)

Sign In for Pricing
View Details
RAE1 antibody
70R-4675 50 ug

RAE1 antibody

Sign In for Pricing
View Details
Olfr450 sgRNA CRISPR Lentivector set (Mouse)
K4229001 3x 1.0 µg

Olfr450 sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
Fehling's Reagent I for sugar determination
LC-6591.1 500 mL

Fehling's Reagent I for sugar determination

Sign In for Pricing
View Details
Human Torsin 3A (TOR3A) ELISA Kit
QY-E02096 96 Tests

Human Torsin 3A (TOR3A) ELISA Kit

Sign In for Pricing
View Details