Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FLJ20674 Rabbit Polyclonal Antibody (FITC)

FLJ20674 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

FLJ20674, MGC1013

UniProt

Q8N0Z9

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human FLJ20674

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: LNVTQWFQVWLQVASGPYQIEVHIVATGTLPNGTLYAARGSQVDFSCNSS

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

59kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_061959

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IDDM17 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K1014308 1.0 µg DNA

IDDM17 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Mouse GDF10 (GrowthDifferentiation Factor 10) Microsample ELISA Kit
ELK9610MS-01 48 Tests

Mouse GDF10 (GrowthDifferentiation Factor 10) Microsample ELISA Kit

Sign In for Pricing
View Details
Mouse GDF10 (GrowthDifferentiation Factor 10) Microsample ELISA Kit
ELK9610MS-02 96 Tests

Mouse GDF10 (GrowthDifferentiation Factor 10) Microsample ELISA Kit

Sign In for Pricing
View Details
Mouse GDF10 (GrowthDifferentiation Factor 10) Microsample ELISA Kit
ELK9610MS-03 5x 96 Tests

Mouse GDF10 (GrowthDifferentiation Factor 10) Microsample ELISA Kit

Sign In for Pricing
View Details
ACADL Rabbit Polyclonal Antibody (BF647)
orb2554419 100 µL

ACADL Rabbit Polyclonal Antibody (BF647)

Sign In for Pricing
View Details
Mouse Monoclonal PEDFR/PNPLA2/ATGL Antibody (494702) [mFluor Violet 500 SE]
FAB5387MFV500 0.1 mL

Mouse Monoclonal PEDFR/PNPLA2/ATGL Antibody (494702) [mFluor Violet 500 SE]

Sign In for Pricing
View Details