Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FLJ20674 Rabbit Polyclonal Antibody (HRP)

FLJ20674 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

FLJ20674, MGC1013

UniProt

Q8N0Z9

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human FLJ20674

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LNVTQWFQVWLQVASGPYQIEVHIVATGTLPNGTLYAARGSQVDFSCNSS

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

59kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_061959

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ReadiLink™ xtra Rapid iFluor® 647 Antibody Labeling Kit *BSA-Compatible*
1963-AAT 2 Labelings

ReadiLink™ xtra Rapid iFluor® 647 Antibody Labeling Kit *BSA-Compatible*

Sign In for Pricing
View Details
Milk Fat Globulin (MFG-06), Biotin conjugate, 0.1mg/mL
BNCB0227-100 1x 100 µL

Milk Fat Globulin (MFG-06), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Frozen Tissue Blocks, Ovary
CB606369 1 Block

Frozen Tissue Blocks, Ovary

Sign In for Pricing
View Details
ALDH1A1 Recombinant Mouse Monoclonal Antibody [8F1-R]
HA601215 100 µL

ALDH1A1 Recombinant Mouse Monoclonal Antibody [8F1-R]

Sign In for Pricing
View Details
TIMM50 (NM_001001563) Human Over-expression Lysate
LY424383 100 µg

TIMM50 (NM_001001563) Human Over-expression Lysate

Sign In for Pricing
View Details
Human CT45A7 activation kit by CRISPRa
GA119446 1 Kit

Human CT45A7 activation kit by CRISPRa

Sign In for Pricing
View Details