Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CRLS1 Rabbit Polyclonal Antibody (HRP)

CRLS1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CLS, CLS1, GCD10, C20orf155, dJ967N21.6

UniProt

Q9UJA2

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human CRLS1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: WTIPNMLSMTRIGLAPVLGYLIIEEDFNIALGVFALAGLTDLLDGFIARN

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

32kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_061968

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ABL1 Antibody
A73947-50UG 50 µg

ABL1 Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal Ficolin-1 Antibody
NBP1-84705 0.1 mL

Rabbit Polyclonal Ficolin-1 Antibody

Sign In for Pricing
View Details
C17orf107 3'UTR Lenti-reporter-Luc Vector
13963081 1.0 µg

C17orf107 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Mouse Phosphoglycerate Mutase 1, Brain ELISA Kit
MBS081560-01 48 Well

Mouse Phosphoglycerate Mutase 1, Brain ELISA Kit

Sign In for Pricing
View Details
Mouse Phosphoglycerate Mutase 1, Brain ELISA Kit
MBS081560-02 96 Well

Mouse Phosphoglycerate Mutase 1, Brain ELISA Kit

Sign In for Pricing
View Details
Mouse Phosphoglycerate Mutase 1, Brain ELISA Kit
MBS081560-03 5x 96 Well

Mouse Phosphoglycerate Mutase 1, Brain ELISA Kit

Sign In for Pricing
View Details