Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC10A3 Rabbit Polyclonal Antibody (HRP)

SLC10A3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

P3, DXS253E

UniProt

P09131

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human SLC10A3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MTFLSTVAATGFLPLSSAIYSRLLSIHETLHVPISKILGTLLFIAIPIAV

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

50kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_062822

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Concanavalin A Coated - 96 well plates - 8 Well Strips on 12 x 8 frame - Black PS
MTB07F4-CON A 10x 96 Well Plates

Concanavalin A Coated - 96 well plates - 8 Well Strips on 12 x 8 frame - Black PS

Sign In for Pricing
View Details
STAT6 pTyr641 Rabbit Polyclonal Antibody
AP01698PU-N 100 µg

STAT6 pTyr641 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
P53 Tumor Suppressor Protein (PCRP-TP53-1F7), CF594 conjugate, 0.1mg/mL
BNC941925-500 1x 500 µL

P53 Tumor Suppressor Protein (PCRP-TP53-1F7), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant EBOV (subtype Zaire, strain H.sapiens-wt/GIN/2014/Kissidougou-C15) VP24 Protein (His Tag)
PKSV030160 100 µg

Recombinant EBOV (subtype Zaire, strain H.sapiens-wt/GIN/2014/Kissidougou-C15) VP24 Protein (His Tag)

Sign In for Pricing
View Details
BOB.1 (B-Cell Marker) (BOB1/2425), 1mg/mL
BNUM2425-50 1x 50 µL

BOB.1 (B-Cell Marker) (BOB1/2425), 1mg/mL

Sign In for Pricing
View Details
Ube2e3 Mouse Gene Knockout Kit (CRISPR)
KN518572 1 Kit

Ube2e3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details