Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CNNM4 Rabbit Polyclonal Antibody (FITC)

CNNM4 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

ACDP4

UniProt

Q6P4Q7

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human CNNM4

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: LLASRMENSPQFPIDGCTTHMENLAEKSELPVVDETTTLLNERNSLLHKA

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

86kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_064569

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FITC-Linked Monoclonal Antibody to Kinesin Family, Member 5A (KIF5A)
MBS2169325-01 0.1 mL

FITC-Linked Monoclonal Antibody to Kinesin Family, Member 5A (KIF5A)

Sign In for Pricing
View Details
FITC-Linked Monoclonal Antibody to Kinesin Family, Member 5A (KIF5A)
MBS2169325-02 0.2 mL

FITC-Linked Monoclonal Antibody to Kinesin Family, Member 5A (KIF5A)

Sign In for Pricing
View Details
FITC-Linked Monoclonal Antibody to Kinesin Family, Member 5A (KIF5A)
MBS2169325-03 0.5 mL

FITC-Linked Monoclonal Antibody to Kinesin Family, Member 5A (KIF5A)

Sign In for Pricing
View Details
FITC-Linked Monoclonal Antibody to Kinesin Family, Member 5A (KIF5A)
MBS2169325-04 1 mL

FITC-Linked Monoclonal Antibody to Kinesin Family, Member 5A (KIF5A)

Sign In for Pricing
View Details
FITC-Linked Monoclonal Antibody to Kinesin Family, Member 5A (KIF5A)
MBS2169325-05 5 mL

FITC-Linked Monoclonal Antibody to Kinesin Family, Member 5A (KIF5A)

Sign In for Pricing
View Details
FITC-Linked Monoclonal Antibody to Kinesin Family, Member 5A (KIF5A)
MBS2169325-06 5x 5 mL

FITC-Linked Monoclonal Antibody to Kinesin Family, Member 5A (KIF5A)

Sign In for Pricing
View Details