Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C2orf33 Rabbit Polyclonal Antibody (HRP)

C2orf33 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

EMPF2, GL004, C2orf33

UniProt

Q9GZY8

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human C2orf33

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VVDAASLRRQIIKLNRRLQLLEEENKERAKREMVMYSITVAFWLLNSWLW

Field of Research

Neuroscience

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

38kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_064579

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Lung
CS628413 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
Human YY1 associated factor 2 (YAF2) activation kit by CRISPRa
GA106881 1 Kit

Human YY1 associated factor 2 (YAF2) activation kit by CRISPRa

Sign In for Pricing
View Details
Dystrophin (DMD) (Marker of Duchenne and Becker Muscular Dystrophy) (DMD/3245), CF568 conjugate, 0.1mg/mL
BNC683245-500 1x 500 µL

Dystrophin (DMD) (Marker of Duchenne and Becker Muscular Dystrophy) (DMD/3245), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Di-p-tolyl Phosphorochloridate
TRC-D494630-10MG 10 mg

Di-p-tolyl Phosphorochloridate

Sign In for Pricing
View Details
FOXA1 Mouse Monoclonal Antibody [A2E9]
HA600022 100 µL

FOXA1 Mouse Monoclonal Antibody [A2E9]

Sign In for Pricing
View Details
SMAD5 Human Gene Knockout Kit (CRISPR)
KN401949 1 Kit

SMAD5 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details