Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Jph2 Rabbit Polyclonal Antibody (FITC)

Jph2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

JP-, Jp2, JP-2, 1110002E14Rik

UniProt

Q9ET78

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: QGKRHGLGIETKGRWLYKGEWTHGFKGRYGIRQSTNSGAKYEGTWNNGLQ

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

75kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_067541

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse EBI3 Protein (Sumo Tag)
MBS2580774-01 0.02 mg

Recombinant Mouse EBI3 Protein (Sumo Tag)

Sign In for Pricing
View Details
Recombinant Mouse EBI3 Protein (Sumo Tag)
MBS2580774-02 0.1 mg

Recombinant Mouse EBI3 Protein (Sumo Tag)

Sign In for Pricing
View Details
Recombinant Mouse EBI3 Protein (Sumo Tag)
MBS2580774-03 5x 0.1 mg

Recombinant Mouse EBI3 Protein (Sumo Tag)

Sign In for Pricing
View Details
Human OR5AL1 Knockout HEK293T cell line
GTR15410452 1 Vial

Human OR5AL1 Knockout HEK293T cell line

Sign In for Pricing
View Details
POPD3, CT (POPDC3, POP3, Popeye domain-containing protein 3) (MaxLight 405)
MBS6335911-01 0.1 mL

POPD3, CT (POPDC3, POP3, Popeye domain-containing protein 3) (MaxLight 405)

Sign In for Pricing
View Details
POPD3, CT (POPDC3, POP3, Popeye domain-containing protein 3) (MaxLight 405)
MBS6335911-02 5x 0.1 mL

POPD3, CT (POPDC3, POP3, Popeye domain-containing protein 3) (MaxLight 405)

Sign In for Pricing
View Details