Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Jph4 Rabbit Polyclonal Antibody (Biotin)

Jph4 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

JP-, JPH, JP-4, JPHL1, 9330157P13Rik

UniProt

Q80WT0

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of MOUSE Jph4

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: KDGFQDGYGTETYSDGGTYQGQWQAGKRHGYGVRQSVPYHQAALLRSPRR

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

44kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MIZF antibody - middle region (ARP32543_P050)
ARP32543_P050 100 µL

MIZF antibody - middle region (ARP32543_P050)

Sign In for Pricing
View Details
HTR3D (NM_182537) Human Tagged ORF Clone
RC211826 10 µg

HTR3D (NM_182537) Human Tagged ORF Clone

Sign In for Pricing
View Details
Blue Fluorescence Protein, Enhanced (EBFP, BFP) discontinued
B2174-93B 100 µg

Blue Fluorescence Protein, Enhanced (EBFP, BFP) discontinued

Sign In for Pricing
View Details
Mouse Complement Factor D (CFD) ELISA Kit
RD-CFD-Mu-48Tests 48 Tests

Mouse Complement Factor D (CFD) ELISA Kit

Sign In for Pricing
View Details
ADRA1B Conjugated Antibody
orb1621268 100 µL

ADRA1B Conjugated Antibody

Sign In for Pricing
View Details
PIK3R2 Antibody
orb523706-01 50 μL

PIK3R2 Antibody

Sign In for Pricing
View Details