Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Jph4 Rabbit Polyclonal Antibody (FITC)

Jph4 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

JP-, JPH, JP-4, JPHL1, 9330157P13Rik

UniProt

Q80WT0

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of MOUSE Jph4

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: KDGFQDGYGTETYSDGGTYQGQWQAGKRHGYGVRQSVPYHQAALLRSPRR

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

44kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-CD43 Antibody-PE labled
MBS8321640-01 25 Assays

Anti-CD43 Antibody-PE labled

Sign In for Pricing
View Details
Anti-CD43 Antibody-PE labled
MBS8321640-02 100 Assays

Anti-CD43 Antibody-PE labled

Sign In for Pricing
View Details
Anti-CD43 Antibody-PE labled
MBS8321640-03 5x 100 Assays

Anti-CD43 Antibody-PE labled

Sign In for Pricing
View Details
AdmiRa-mmu-mir-8109 Virus
mm1080 250 µL

AdmiRa-mmu-mir-8109 Virus

Sign In for Pricing
View Details
Anti-Deoxyribonuclease B Antibody (Anti-DNaseB) BioAssayTM ELISA Kit (Human) discontinued
023459-01 48 Tests

Anti-Deoxyribonuclease B Antibody (Anti-DNaseB) BioAssayTM ELISA Kit (Human) discontinued

Sign In for Pricing
View Details
Anti-Deoxyribonuclease B Antibody (Anti-DNaseB) BioAssayTM ELISA Kit (Human) discontinued
023459-02 96 Tests

Anti-Deoxyribonuclease B Antibody (Anti-DNaseB) BioAssayTM ELISA Kit (Human) discontinued

Sign In for Pricing
View Details