Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Jph4 Rabbit Polyclonal Antibody (HRP)

Jph4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

JP-, JPH, JP-4, JPHL1, 9330157P13Rik

UniProt

Q80WT0

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of MOUSE Jph4

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KDGFQDGYGTETYSDGGTYQGQWQAGKRHGYGVRQSVPYHQAALLRSPRR

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

44kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human FTH protein
orb737458-01 10 µg

Human FTH protein

Sign In for Pricing
View Details
Human FTH protein
orb737458-02 50 µg

Human FTH protein

Sign In for Pricing
View Details
Human FTH protein
orb737458-03 500 µg

Human FTH protein

Sign In for Pricing
View Details
Human FTH protein
orb737458-04 1 mg

Human FTH protein

Sign In for Pricing
View Details
NFE4 (Transcription Factor NF-E4, NFE4) (MaxLight 405) discontinued
302598-ML405 100 µL

NFE4 (Transcription Factor NF-E4, NFE4) (MaxLight 405) discontinued

Sign In for Pricing
View Details
SLCO2A1 Antibody (Biotin)
orb517799-01 50 µg

SLCO2A1 Antibody (Biotin)

Sign In for Pricing
View Details