Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NIPAL3 Rabbit Polyclonal Antibody (FITC)

NIPAL3 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

NPAL3, SLC57A5, DJ462O23.2

UniProt

Q6P499

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human NIPAL3

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: DGSHSAALKLQQLPPTSSSSAVSEASFSYKENLIGALLAIFGHLVVSIAL

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

24kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human SYT7 Knockout A549 cell line
GTR15417572 1 Vial

Human SYT7 Knockout A549 cell line

Sign In for Pricing
View Details
PSMB6 3'UTR Luciferase Stable Cell Line
TU019044 1.0 mL

PSMB6 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Anti-col6a2 Antibody Picoband®
A03194-3 100 µg/Vial

Anti-col6a2 Antibody Picoband®

Sign In for Pricing
View Details
Human ELL-associated factor 2 (EAF2) ELISA Kit
MBS166468-01 48 Well

Human ELL-associated factor 2 (EAF2) ELISA Kit

Sign In for Pricing
View Details
Human ELL-associated factor 2 (EAF2) ELISA Kit
MBS166468-02 96 Well

Human ELL-associated factor 2 (EAF2) ELISA Kit

Sign In for Pricing
View Details
Human ELL-associated factor 2 (EAF2) ELISA Kit
MBS166468-03 5x 96 Well

Human ELL-associated factor 2 (EAF2) ELISA Kit

Sign In for Pricing
View Details