Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NIPAL3 Rabbit Polyclonal Antibody (HRP)

NIPAL3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

NPAL3, SLC57A5, DJ462O23.2

UniProt

Q6P499

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human NIPAL3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: DGSHSAALKLQQLPPTSSSSAVSEASFSYKENLIGALLAIFGHLVVSIAL

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

24kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SMG1 Human Gene Knockout Kit (CRISPR)
KN424277 1 Kit

SMG1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Vaccum Pump BVAP-303
BVAP-303 1 Unit

Vaccum Pump BVAP-303

Sign In for Pricing
View Details
Elab Fluor® 488 Anti-Human CD64 Antibody[10.1]
E-AB-F1082L-01 20 Tests

Elab Fluor® 488 Anti-Human CD64 Antibody[10.1]

Sign In for Pricing
View Details
Elab Fluor® 488 Anti-Human CD64 Antibody[10.1]
E-AB-F1082L-02 100 Tests

Elab Fluor® 488 Anti-Human CD64 Antibody[10.1]

Sign In for Pricing
View Details
Elab Fluor® 488 Anti-Human CD64 Antibody[10.1]
E-AB-F1082L-03 2x 100 Tests

Elab Fluor® 488 Anti-Human CD64 Antibody[10.1]

Sign In for Pricing
View Details
TTLL13P (Center) Rabbit Polyclonal Antibody
AP54409PU-N 400 µL

TTLL13P (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details