Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Atp10d Rabbit Polyclonal Antibody (FITC)

Atp10d Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Atp10d

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Rat

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: YAKRGLRTLCVAKKVMSDTEYAEWLRNHFLAETSIDNREELLVESAMRLE

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

153kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

XP_002725021

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Annexin A2 (ANXA2) (NM_001002858) Human Recombinant Protein
TP315009L 1 mg

Annexin A2 (ANXA2) (NM_001002858) Human Recombinant Protein

Sign In for Pricing
View Details
Slc26a2 Mouse Gene Knockout Kit (CRISPR)
KN516004 1 Kit

Slc26a2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Benzyl Phenylephrone Hydrochloride
TRC-B288635-25MG 25 mg

Benzyl Phenylephrone Hydrochloride

Sign In for Pricing
View Details
CD20 / MS4A1 (B-Cell Marker) (IGEL/1497R), Biotin conjugate, 0.1mg/mL
BNCB1497-500 1x 500 µL

CD20 / MS4A1 (B-Cell Marker) (IGEL/1497R), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
DCTN4 Polyclonal Antibody
E-AB-11145-01 20 µL

DCTN4 Polyclonal Antibody

Sign In for Pricing
View Details
DCTN4 Polyclonal Antibody
E-AB-11145-02 60 µL

DCTN4 Polyclonal Antibody

Sign In for Pricing
View Details