Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL22 Rabbit Polyclonal Antibody (Biotin)

IL22 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

TIFa, IL-21, IL-22, ILTIF, IL-TIF, IL-D110, zcyto18, TIFIL-23

UniProt

Q9GZX6

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human IL22

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: CHIEGDDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACI

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

20kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_065386

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sheep anti Contactin Associated Protein 1 antibody  ELISA Kit
MBS7278669-01 48 Well

Sheep anti Contactin Associated Protein 1 antibody  ELISA Kit

Sign In for Pricing
View Details
Sheep anti Contactin Associated Protein 1 antibody  ELISA Kit
MBS7278669-02 96 Well

Sheep anti Contactin Associated Protein 1 antibody  ELISA Kit

Sign In for Pricing
View Details
Sheep anti Contactin Associated Protein 1 antibody  ELISA Kit
MBS7278669-03 5x 96 Well

Sheep anti Contactin Associated Protein 1 antibody  ELISA Kit

Sign In for Pricing
View Details
Sheep anti Contactin Associated Protein 1 antibody  ELISA Kit
MBS7278669-04 10x 96 Well

Sheep anti Contactin Associated Protein 1 antibody  ELISA Kit

Sign In for Pricing
View Details
Dipivefrin Hydrochloride
E0019-25mg 25 mg

Dipivefrin Hydrochloride

Sign In for Pricing
View Details
2-Deoxokanshone M
T88427-01 10 mg

2-Deoxokanshone M

Sign In for Pricing
View Details