Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL22 Rabbit Polyclonal Antibody (Biotin)

IL22 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

TIFa, IL-21, IL-22, ILTIF, IL-TIF, IL-D110, zcyto18, TIFIL-23

UniProt

Q9GZX6

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human IL22

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: CHIEGDDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACI

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

20kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_065386

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LOC147664 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV814361 1.0 µg DNA

LOC147664 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
Human connective tissue growth factor (CTGF; CCN2) ELISA Kit
YP-W10815-01 48 Tests

Human connective tissue growth factor (CTGF; CCN2) ELISA Kit

Sign In for Pricing
View Details
Human connective tissue growth factor (CTGF; CCN2) ELISA Kit
YP-W10815-02 96 Tests

Human connective tissue growth factor (CTGF; CCN2) ELISA Kit

Sign In for Pricing
View Details
C8orf41 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV812596 1.0 µg DNA

C8orf41 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
NDF2 Antibody
orb2627424 100 µL

NDF2 Antibody

Sign In for Pricing
View Details
Depdc5 3'UTR GFP Stable Cell Line
TU253350 1.0 mL

Depdc5 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details