Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C20orf3 Rabbit Polyclonal Antibody (Biotin)

C20orf3 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

BSCv, C20orf3

UniProt

Q9HDC9

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human C20orf3

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: EPPLLLGVLHPNTKLRQAERLFENQLVGPESIAHIGDVMFTGTADGRVVK

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

46kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_065392

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SELE Rabbit pAb
E45R24708N-50 50 µL

SELE Rabbit pAb

Sign In for Pricing
View Details
Phospho-AMPK α1/ AMPK α2 (Thr 183/ Thr 172) Rabbit mAb
F1561-100uL 100 µL

Phospho-AMPK α1/ AMPK α2 (Thr 183/ Thr 172) Rabbit mAb

Sign In for Pricing
View Details
THEMIS Rabbit Polyclonal Antibody (Fluoro488)
orb3099557 100 µg

THEMIS Rabbit Polyclonal Antibody (Fluoro488)

Sign In for Pricing
View Details
Cbp/p300 Interacting Transactivator, With Glu/Asp Rich Carboxy Terminal Domain 1 (CITED1) BioAssayTM ELISA Kit (Human)
589097 96 Tests

Cbp/p300 Interacting Transactivator, With Glu/Asp Rich Carboxy Terminal Domain 1 (CITED1) BioAssayTM ELISA Kit (Human)

Sign In for Pricing
View Details
Tomm7 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K3047808 1.0 µg DNA

Tomm7 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
L-Ascorbic Acid 3-Sulfate-13C6
453221 1 mg

L-Ascorbic Acid 3-Sulfate-13C6

Sign In for Pricing
View Details