Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C20orf3 Rabbit Polyclonal Antibody (Biotin)

C20orf3 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

BSCv, C20orf3

UniProt

Q9HDC9

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human C20orf3

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: EPPLLLGVLHPNTKLRQAERLFENQLVGPESIAHIGDVMFTGTADGRVVK

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

46kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_065392

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RET, NT (C166) (RET, CDHF12, CDHR16, PTC, RET51, Proto-oncogene tyrosine-protein kinase receptor Ret, Cadherin family member 12, Proto-oncogene c-Ret, Soluble RET kinase fragment, Extracellular cell-membrane anchored RET cadherin 120kD fragment) (MaxLight 550) discontinued
040967-ML550 100 µL

RET, NT (C166) (RET, CDHF12, CDHR16, PTC, RET51, Proto-oncogene tyrosine-protein kinase receptor Ret, Cadherin family member 12, Proto-oncogene c-Ret, Soluble RET kinase fragment, Extracellular cell-membrane anchored RET cadherin 120kD fragment) (MaxLight 550) discontinued

Sign In for Pricing
View Details
Rabbit Anti-Dog IgG (H&L) Biotin
YLF0029-01 100 µL

Rabbit Anti-Dog IgG (H&L) Biotin

Sign In for Pricing
View Details
Rabbit Anti-Dog IgG (H&L) Biotin
YLF0029-02 500 µL

Rabbit Anti-Dog IgG (H&L) Biotin

Sign In for Pricing
View Details
Rabbit Anti-Dog IgG (H&L) Biotin
YLF0029-03 1 mL

Rabbit Anti-Dog IgG (H&L) Biotin

Sign In for Pricing
View Details
Phospho-CSF1R (Tyr708) Antibody
A47502-100UL 100 µL

Phospho-CSF1R (Tyr708) Antibody

Sign In for Pricing
View Details
Aha2 Antibody: HRP
MBS805354-01 0.1 mg

Aha2 Antibody: HRP

Sign In for Pricing
View Details