Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C20orf3 Rabbit Polyclonal Antibody (HRP)

C20orf3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

BSCv, C20orf3

UniProt

Q9HDC9

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human C20orf3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: EPPLLLGVLHPNTKLRQAERLFENQLVGPESIAHIGDVMFTGTADGRVVK

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

46kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_065392

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Prostate
CS505281 5x 5 µm

Frozen Tissue Sections, Prostate

Sign In for Pricing
View Details
TGFalpha (TG86), CF740 conjugate, 0.1mg/mL
BNC740786-500 1x 500 µL

TGFalpha (TG86), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
AHA1 (AHSA1) Rabbit Monoclonal Antibody [Clone ID: R01-8D9]
TA421479 100 µL

AHA1 (AHSA1) Rabbit Monoclonal Antibody [Clone ID: R01-8D9]

Sign In for Pricing
View Details
Low-Serum, VitroPlus III, Complete Medium for primary cell cultures
PC00B1 500 mL

Low-Serum, VitroPlus III, Complete Medium for primary cell cultures

Sign In for Pricing
View Details
RAN (N-term) Rabbit Polyclonal Antibody
AP17702PU-N 400 µL

RAN (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
NUR77 Recombinant Rabbit monoclonal Antibody
HA750397 100 µL

NUR77 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details