Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C20orf3 Rabbit Polyclonal Antibody (HRP)

C20orf3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

BSCv, C20orf3

UniProt

Q9HDC9

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human C20orf3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: EPPLLLGVLHPNTKLRQAERLFENQLVGPESIAHIGDVMFTGTADGRVVK

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

46kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_065392

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Density Balance BBAL-302
BBAL-302 1 Unit

Density Balance BBAL-302

Sign In for Pricing
View Details
SDHAF1 Mouse Monoclonal Antibody [Clone ID: OTI2G6]
CF809713 100 µg

SDHAF1 Mouse Monoclonal Antibody [Clone ID: OTI2G6]

Sign In for Pricing
View Details
Tissue Total RNA, Colon: right
CR559199 5 µg

Tissue Total RNA, Colon: right

Sign In for Pricing
View Details
Frozen Tissue Sections, Thyroid gland
CS505859 5x 5 µm

Frozen Tissue Sections, Thyroid gland

Sign In for Pricing
View Details
Mouse IgG2a (Fcγ Fragment specific), AlpHcAbs® Goat antibody (Biotin)
HA710137 100 µg

Mouse IgG2a (Fcγ Fragment specific), AlpHcAbs® Goat antibody (Biotin)

Sign In for Pricing
View Details
GRP78 / BIP Recombinant Mouse monoclonal Antibody
HA610190 100 µg

GRP78 / BIP Recombinant Mouse monoclonal Antibody

Sign In for Pricing
View Details