Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C20orf3 Rabbit Polyclonal Antibody (Biotin)

C20orf3 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

BSCv, C20orf3

UniProt

Q9HDC9

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human C20orf3

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: QETVMKFVPRYSLVLELSDSGAFRRSLHDPDGLVATYISEVHEHDGHLYL

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

46kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_065392

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HRH4 Peptide - C-terminal region (AAP80770)
AAP80770-100UG 100 µg

HRH4 Peptide - C-terminal region (AAP80770)

Sign In for Pricing
View Details
Sbsn Mouse Pre-designed siRNA Set A
HY-RS22317 1 Set

Sbsn Mouse Pre-designed siRNA Set A

Sign In for Pricing
View Details
CD68, ID (DKFZp686M18236, GP110, Macrophage Antigen CD68, Macrosialin, Scavenger Receptor Class D Member 1, SCARD1) (MaxLight 490) discontinued
033530-ML490 100 µL

CD68, ID (DKFZp686M18236, GP110, Macrophage Antigen CD68, Macrosialin, Scavenger Receptor Class D Member 1, SCARD1) (MaxLight 490) discontinued

Sign In for Pricing
View Details
Recombinant Bacillus subtilis Uncharacterized protein yqxH (yqxH), partial
MBS7060512 Inquire

Recombinant Bacillus subtilis Uncharacterized protein yqxH (yqxH), partial

Sign In for Pricing
View Details
PUS1 Rabbit pAb (APR28415N)
APR28415N-01 50 µL

PUS1 Rabbit pAb (APR28415N)

Sign In for Pricing
View Details
PUS1 Rabbit pAb (APR28415N)
APR28415N-02 100 µL

PUS1 Rabbit pAb (APR28415N)

Sign In for Pricing
View Details