Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C20orf3 Rabbit Polyclonal Antibody (HRP)

C20orf3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

BSCv, C20orf3

UniProt

Q9HDC9

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human C20orf3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: QETVMKFVPRYSLVLELSDSGAFRRSLHDPDGLVATYISEVHEHDGHLYL

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

46kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_065392

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Electric lift patient transfer Wheelchair BHBD-1106
BHBD-1106 1 Unit

Electric lift patient transfer Wheelchair BHBD-1106

Sign In for Pricing
View Details
Fast T4 DNA ligase (400 U/μL)
10299ES42 400 KU

Fast T4 DNA ligase (400 U/μL)

Sign In for Pricing
View Details
RED (IK) Human Gene Knockout Kit (CRISPR)
KN401246 1 Kit

RED (IK) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ARL5B (C-term) Rabbit Polyclonal Antibody
AP50247PU-N 400 µL

ARL5B (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tmco1 (NM_001039483) Mouse Tagged ORF Clone
MG201773 10 µg

Tmco1 (NM_001039483) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
CD8A (Cytotoxic- & Suppressor T-Cell Marker) (UCHT4), 0.2mg/mL
BNUB1628-500 1x 500 µL

CD8A (Cytotoxic- & Suppressor T-Cell Marker) (UCHT4), 0.2mg/mL

Sign In for Pricing
View Details