Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Amhr2 Rabbit Polyclonal Antibody (Biotin)

Amhr2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

M, C14, Mrii, Misiir, Misrii

UniProt

Q8K592

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: PAAAQVSPNRRTCVFFEAPGVRGSTKTLGEMVDAGPGPPKGIRCLYSHCC

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

61kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_653130

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bovine Endotoxin Core Antibody IgM (EndoC-IgM) ELISA Kit
MBS9911118-01 48 Well

Bovine Endotoxin Core Antibody IgM (EndoC-IgM) ELISA Kit

Sign In for Pricing
View Details
Bovine Endotoxin Core Antibody IgM (EndoC-IgM) ELISA Kit
MBS9911118-02 96 Well

Bovine Endotoxin Core Antibody IgM (EndoC-IgM) ELISA Kit

Sign In for Pricing
View Details
Bovine Endotoxin Core Antibody IgM (EndoC-IgM) ELISA Kit
MBS9911118-03 5x 96 Well

Bovine Endotoxin Core Antibody IgM (EndoC-IgM) ELISA Kit

Sign In for Pricing
View Details
Bovine Endotoxin Core Antibody IgM (EndoC-IgM) ELISA Kit
MBS9911118-04 10x 96 Well

Bovine Endotoxin Core Antibody IgM (EndoC-IgM) ELISA Kit

Sign In for Pricing
View Details
S Tag Peptide
P9816-5mg 5 mg/mL x 1 mL

S Tag Peptide

Sign In for Pricing
View Details
PRUNEP1 Protein Vector (Human) (pPM-C-HA)
PV113684 500 ng

PRUNEP1 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details