Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

JPH1 Rabbit Polyclonal Antibody (HRP)

JPH1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

JP1, JP-1, CMT2K

UniProt

Q9HDC5

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human JPH1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SNGELHSQYHGYYVKLNAPQHPPVDVEDGDGSSQSSSALVHKPSANKWSP

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

72kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_065698

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

SUMO1 (1-97) Human Protein
AR09173PU-N 100 µg

SUMO1 (1-97) Human Protein

Sign In for Pricing
View Details
BTBD19 Antibody - C-terminal region : FITC (ARP69369_P050-FITC)
ARP69369_P050-FITC 100 µL

BTBD19 Antibody - C-terminal region : FITC (ARP69369_P050-FITC)

Sign In for Pricing
View Details
Srf (NM_020493) Mouse Tagged Lenti ORF Clone
MR208120L4 10 µg

Srf (NM_020493) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
AKT3 (RAC-gamma Serine/Threonine-protein Kinase, Protein Kinase Akt-3, Protein Kinase B gamma, PKB gamma, RAC-PK-gamma, STK-2, PKBG) (APC)
123181-APC 100 µL

AKT3 (RAC-gamma Serine/Threonine-protein Kinase, Protein Kinase Akt-3, Protein Kinase B gamma, PKB gamma, RAC-PK-gamma, STK-2, PKBG) (APC)

Sign In for Pricing
View Details
AAMP discontinued
532591-01 30ul

AAMP discontinued

Sign In for Pricing
View Details
AAMP discontinued
532591-02 100 µL

AAMP discontinued

Sign In for Pricing
View Details