Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

JPH3 Rabbit Polyclonal Antibody (HRP)

JPH3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

JP3, HDL2, JP-3, TNRC22, CAGL237

UniProt

Q8WXH2

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human JPH3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SSGGRFNFDDGGSYCGGWEDGKAHGHGVCTGPKGQGEYTGSWSHGFEVLG

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

81kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_065706

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(R)-4-Bromo Phenylephrine Hydrochloride
TRC-B686835-1MG 1 mg

(R)-4-Bromo Phenylephrine Hydrochloride

Sign In for Pricing
View Details
PE/Cyanine7 Anti-Mouse CD25 Antibody[PC-61.5.3]
E-AB-F1102UH-01 25 µg

PE/Cyanine7 Anti-Mouse CD25 Antibody[PC-61.5.3]

Sign In for Pricing
View Details
PE/Cyanine7 Anti-Mouse CD25 Antibody[PC-61.5.3]
E-AB-F1102UH-02 100 µg

PE/Cyanine7 Anti-Mouse CD25 Antibody[PC-61.5.3]

Sign In for Pricing
View Details
Frozen Tissue Sections, Gastroesophageal junction
CS628139 5x 5 µm

Frozen Tissue Sections, Gastroesophageal junction

Sign In for Pricing
View Details
Frozen Tissue Sections, Breast
CS625698 5x 5 µm

Frozen Tissue Sections, Breast

Sign In for Pricing
View Details
N-Deacetyl Colchiceine
TRC-D198900-500MG 500 mg

N-Deacetyl Colchiceine

Sign In for Pricing
View Details