Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMCC3 Rabbit Polyclonal Antibody (FITC)

TMCC3 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

KIAA1145

UniProt

Q9ULS5

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human TMCC3

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: MPGSDTALTVDRTYSDPGRHHRCKSRVERHDMNTLSLPLNIRRGGSDTNL

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

54kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_065749

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF521 Rabbit Polyclonal Antibody (Cy7)
orb1034550 100 µL

ZNF521 Rabbit Polyclonal Antibody (Cy7)

Sign In for Pricing
View Details
RELA, NT (RELA, NFKB3, Transcription factor p65, Nuclear factor NF-kappa-B p65 subunit, Nuclear factor of kappa light polypeptide gene enhancer in B Cells 3) (MaxLight 650) discontinued
040950-ML650 100 µL

RELA, NT (RELA, NFKB3, Transcription factor p65, Nuclear factor NF-kappa-B p65 subunit, Nuclear factor of kappa light polypeptide gene enhancer in B Cells 3) (MaxLight 650) discontinued

Sign In for Pricing
View Details
MAFF Rabbit Polyclonal Antibody (BF555)
orb2478398 100 µL

MAFF Rabbit Polyclonal Antibody (BF555)

Sign In for Pricing
View Details
Lentiviral mouse Cst9 shRNA (UAS) - Lentiviral mouse Cst9 shRNA (UAS, RFP) (100)
GTR15112716 1 Vial

Lentiviral mouse Cst9 shRNA (UAS) - Lentiviral mouse Cst9 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
Recombinant Heterodontus portusjacksoni Hemoglobin subunit alpha (HBA)
MBS1170276-01 0.02 mg (E-Coli)

Recombinant Heterodontus portusjacksoni Hemoglobin subunit alpha (HBA)

Sign In for Pricing
View Details
Recombinant Heterodontus portusjacksoni Hemoglobin subunit alpha (HBA)
MBS1170276-02 0.1 mg (E-Coli)

Recombinant Heterodontus portusjacksoni Hemoglobin subunit alpha (HBA)

Sign In for Pricing
View Details