Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KIAA1324 Rabbit Polyclonal Antibody (HRP)

KIAA1324 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

EIG121, KIAA1324

UniProt

Q6UXG2

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human KIAA1324

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PCAEGRYSLGTGIRFDEWDELPHGFASLSANMELDDSAAESTGNCTSSKW

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

111kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_065826

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Integrin, alpha 1 (ITGA1, CD49 Antigen-like Family Member A, CD49a, CD49a Antigen, Laminin and Collagen Receptor, Very Late Activation Protein 1, VLA1, VLA-1) (FITC)
MBS6482031-01 0.2 mL

Integrin, alpha 1 (ITGA1, CD49 Antigen-like Family Member A, CD49a, CD49a Antigen, Laminin and Collagen Receptor, Very Late Activation Protein 1, VLA1, VLA-1) (FITC)

Sign In for Pricing
View Details
Integrin, alpha 1 (ITGA1, CD49 Antigen-like Family Member A, CD49a, CD49a Antigen, Laminin and Collagen Receptor, Very Late Activation Protein 1, VLA1, VLA-1) (FITC)
MBS6482031-02 5x 0.2 mL

Integrin, alpha 1 (ITGA1, CD49 Antigen-like Family Member A, CD49a, CD49a Antigen, Laminin and Collagen Receptor, Very Late Activation Protein 1, VLA1, VLA-1) (FITC)

Sign In for Pricing
View Details
Captopril
C08238-50mg 50 mg

Captopril

Sign In for Pricing
View Details
PI 3-Kinase p85β Polyclonal Antibody
E20-53420 100 µg

PI 3-Kinase p85β Polyclonal Antibody

Sign In for Pricing
View Details
Anti-CD68 Antibody
MBS8309871-01 0.03 mL

Anti-CD68 Antibody

Sign In for Pricing
View Details
Anti-CD68 Antibody
MBS8309871-02 0.05 mL

Anti-CD68 Antibody

Sign In for Pricing
View Details