Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TXNDC16 Rabbit Polyclonal Antibody (Biotin)

TXNDC16 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

ERp90, KIAA1344

UniProt

Q9P2K2

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human TXNDC16

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: EVAEDPQQVSTVHLQLGLPLVFIVSQQATYEADRRTAEWVAWRLLGKAGV

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

93kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_065835

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human KLF7 Pre-designed siRNA Set B
SI008239B 1 Each

Human KLF7 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Human LIMS2 Protein Lysate
MBS8414518-01 0.02 mg

Human LIMS2 Protein Lysate

Sign In for Pricing
View Details
Human LIMS2 Protein Lysate
MBS8414518-02 5x 0.02 mg

Human LIMS2 Protein Lysate

Sign In for Pricing
View Details
TRNAU2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
LV788741 1.0 µg DNA

TRNAU2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
SENP3 (SUMO1/sentrin/SMT3 Specific Peptidase 3, DKFZp586K0919, DKFZp762A152, SMT3IP1, SSP3) (APC)
MBS6451631-01 0.1 mL

SENP3 (SUMO1/sentrin/SMT3 Specific Peptidase 3, DKFZp586K0919, DKFZp762A152, SMT3IP1, SSP3) (APC)

Sign In for Pricing
View Details
SENP3 (SUMO1/sentrin/SMT3 Specific Peptidase 3, DKFZp586K0919, DKFZp762A152, SMT3IP1, SSP3) (APC)
MBS6451631-02 5x 0.1 mL

SENP3 (SUMO1/sentrin/SMT3 Specific Peptidase 3, DKFZp586K0919, DKFZp762A152, SMT3IP1, SSP3) (APC)

Sign In for Pricing
View Details