Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TXNDC16 Rabbit Polyclonal Antibody (HRP)

TXNDC16 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ERp90, KIAA1344

UniProt

Q9P2K2

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human TXNDC16

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: EVAEDPQQVSTVHLQLGLPLVFIVSQQATYEADRRTAEWVAWRLLGKAGV

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

93kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_065835

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FBXO6 (F-box Only Protein 6, F-Box/G-domain Protein 2, F-box Protein That Recognizes Sugar Chains 2, FBG 2, FBG2, FBX 6, FBX6) (HRP)
126705-HRP 100 µL

FBXO6 (F-box Only Protein 6, F-Box/G-domain Protein 2, F-box Protein That Recognizes Sugar Chains 2, FBG 2, FBG2, FBX 6, FBX6) (HRP)

Sign In for Pricing
View Details
Turbo Super Competent Cells
D1093S 10x 100 μL

Turbo Super Competent Cells

Sign In for Pricing
View Details
4,4,4-Trifluorobutyraldehyde, tech.
abx181141-01 1 g

4,4,4-Trifluorobutyraldehyde, tech.

Sign In for Pricing
View Details
4,4,4-Trifluorobutyraldehyde, tech.
abx181141-02 5 g

4,4,4-Trifluorobutyraldehyde, tech.

Sign In for Pricing
View Details
L-Selectin / CD62L (SELL) Antibody
abx139856 0.1 mg

L-Selectin / CD62L (SELL) Antibody

Sign In for Pricing
View Details
Vmn2r32 Protein Lysate (Mouse) with C-HA Tag
49774034 100 µg

Vmn2r32 Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details