Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IGSF9 Rabbit Polyclonal Antibody (HRP)

IGSF9 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Nrt1, IGSF9A, FP18798

UniProt

Q9P2J2

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human IGSF9

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SPRIDPDYVGRVRLQKGASLQIEGLRVEDQGWYECRVFFLDQHIPEDDFA

Field of Research

Neuroscience

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

125kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_065840

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse F7 activation kit by CRISPRa
GA201341 1 Kit

Mouse F7 activation kit by CRISPRa

Sign In for Pricing
View Details
Texas Red Conjugated Dioclea grandiflora Lectin (legume) -DGL-
T-9002-1 1 mg

Texas Red Conjugated Dioclea grandiflora Lectin (legume) -DGL-

Sign In for Pricing
View Details
MAGEB1 (NM_177404) Human Recombinant Protein
TP324906M 100 µg

MAGEB1 (NM_177404) Human Recombinant Protein

Sign In for Pricing
View Details
Calcineurin B / PPP3R1 (CALNB/2342), 0.2mg/mL
BNUB2342-100 1x 100 µL

Calcineurin B / PPP3R1 (CALNB/2342), 0.2mg/mL

Sign In for Pricing
View Details
Human Kappa Light Chain / IGKC (B-Cell Marker) (KLC2886R), CF594 conjugate, 0.1mg/mL
BNC942886-500 1x 500 µL

Human Kappa Light Chain / IGKC (B-Cell Marker) (KLC2886R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Aqp1 Mouse Gene Knockout Kit (CRISPR)
KN501448 1 Kit

Aqp1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details