Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GPR107 Rabbit Polyclonal Antibody (Biotin)

GPR107 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

GCDRP, LUSTR1, bA138E2.2

UniProt

Q5VW38

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human GP107

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: SKRSTVDSKAMGEKSFSVHNNGGAVSFQFFFNISTDDQEGLYSLYFHKCL

Purification

Affinity purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

66kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GPR52, Human (HEK293, Flag, His)
HY-P703263 1 Each

GPR52, Human (HEK293, Flag, His)

Sign In for Pricing
View Details
REG4 Polyclonal Antibody
ANT-14131-100ug 100 µg

REG4 Polyclonal Antibody

Sign In for Pricing
View Details
Olr1022 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)
LV635387 1.0 µg DNA

Olr1022 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
BTK (Bruton's Tyrosine Kinase, AGMX1, AT, ATK, BPK, IMD1, MGC126261, MGC126262, PSCTK1, XLA) (FITC)
MBS6408921-01 0.1 mL

BTK (Bruton's Tyrosine Kinase, AGMX1, AT, ATK, BPK, IMD1, MGC126261, MGC126262, PSCTK1, XLA) (FITC)

Sign In for Pricing
View Details
BTK (Bruton's Tyrosine Kinase, AGMX1, AT, ATK, BPK, IMD1, MGC126261, MGC126262, PSCTK1, XLA) (FITC)
MBS6408921-02 5x 0.1 mL

BTK (Bruton's Tyrosine Kinase, AGMX1, AT, ATK, BPK, IMD1, MGC126261, MGC126262, PSCTK1, XLA) (FITC)

Sign In for Pricing
View Details
Rat Monoclonal TSPAN8/TM4SF3 Antibody (458811) [Allophycocyanin/Cy7]
FAB4734APCCY7 0.1 mL

Rat Monoclonal TSPAN8/TM4SF3 Antibody (458811) [Allophycocyanin/Cy7]

Sign In for Pricing
View Details