Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SCUBE2 Rabbit Polyclonal Antibody (FITC)

SCUBE2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

CEGB1, CEGF1, CEGP1, scube/You

UniProt

Q9NQ36

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human SCUBE2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: KTPEAWNMSECGGLCQPGEYSADGFAPCQLCALGTFQPEAGRTSCFPCGG

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

110kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_066025

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ethylene Glycol Mono-tert-butyl Ether
sc-486494 25 mL

Ethylene Glycol Mono-tert-butyl Ether

Sign In for Pricing
View Details
Recombinant Thermotoga sp. ATP synthase subunit b (atpF)
orb2930897-01 20 µg

Recombinant Thermotoga sp. ATP synthase subunit b (atpF)

Sign In for Pricing
View Details
Recombinant Thermotoga sp. ATP synthase subunit b (atpF)
orb2930897-02 100 µg

Recombinant Thermotoga sp. ATP synthase subunit b (atpF)

Sign In for Pricing
View Details
Bovine IGFBP4 ELISA Kit (Ready to Use)
orb549233-01 48 Tests

Bovine IGFBP4 ELISA Kit (Ready to Use)

Sign In for Pricing
View Details
Bovine IGFBP4 ELISA Kit (Ready to Use)
orb549233-02 96 Tests

Bovine IGFBP4 ELISA Kit (Ready to Use)

Sign In for Pricing
View Details
Recombinant Cricetulus griseus Poly [ADP-ribose] polymerase 1 (PARP1), partial
MBS1376257 Inquire

Recombinant Cricetulus griseus Poly [ADP-ribose] polymerase 1 (PARP1), partial

Sign In for Pricing
View Details