Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NMB Rabbit Polyclonal Antibody (Biotin)

NMB Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

NMB

UniProt

P08949

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human NMB

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: KIRVHSRGNLWATGHFMGKKSLEPSSPSPLGTAPHTSLRDQRLQLSHDLL

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

13kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Guinea pig, Human, Rabbit

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

StirMantle for spherical flask 500ml, 500W, 230V StirControl not included.
100D TEM107 1 Each

StirMantle for spherical flask 500ml, 500W, 230V StirControl not included.

Sign In for Pricing
View Details
DUSP28 (NM_001033575) Human Recombinant Protein
PH38687M5 20 µg

DUSP28 (NM_001033575) Human Recombinant Protein

Sign In for Pricing
View Details
PIN4 (Peptidyl-prolyl Cis-trans Isomerase NIMA-interacting 4, Peptidyl-prolyl Cis-trans Isomerase Pin4, PPIase Pin4, Rotamase Pin4, Parvulin-14, Par14, Parvulin-17, Par17, Peptidyl-prolyl Cis/trans Isomerase EPVH, hEPVH) (MaxLight 650)
MBS6389457-01 0.1 mL

PIN4 (Peptidyl-prolyl Cis-trans Isomerase NIMA-interacting 4, Peptidyl-prolyl Cis-trans Isomerase Pin4, PPIase Pin4, Rotamase Pin4, Parvulin-14, Par14, Parvulin-17, Par17, Peptidyl-prolyl Cis/trans Isomerase EPVH, hEPVH) (MaxLight 650)

Sign In for Pricing
View Details
PIN4 (Peptidyl-prolyl Cis-trans Isomerase NIMA-interacting 4, Peptidyl-prolyl Cis-trans Isomerase Pin4, PPIase Pin4, Rotamase Pin4, Parvulin-14, Par14, Parvulin-17, Par17, Peptidyl-prolyl Cis/trans Isomerase EPVH, hEPVH) (MaxLight 650)
MBS6389457-02 5x 0.1 mL

PIN4 (Peptidyl-prolyl Cis-trans Isomerase NIMA-interacting 4, Peptidyl-prolyl Cis-trans Isomerase Pin4, PPIase Pin4, Rotamase Pin4, Parvulin-14, Par14, Parvulin-17, Par17, Peptidyl-prolyl Cis/trans Isomerase EPVH, hEPVH) (MaxLight 650)

Sign In for Pricing
View Details
Aadat siRNA Oligos set (Rat)
10989176 3x 5 nmol

Aadat siRNA Oligos set (Rat)

Sign In for Pricing
View Details
Mouse Monoclonal Proteasome 20S alpha 6 Antibody (OTI4C9) [mFluor Violet 610 SE]
NBP2-73637MFV610 0.1 mL

Mouse Monoclonal Proteasome 20S alpha 6 Antibody (OTI4C9) [mFluor Violet 610 SE]

Sign In for Pricing
View Details