Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NMB Rabbit Polyclonal Antibody (FITC)

NMB Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

NMB

UniProt

P08949

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human NMB

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: KIRVHSRGNLWATGHFMGKKSLEPSSPSPLGTAPHTSLRDQRLQLSHDLL

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

13kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Guinea pig, Human, Rabbit

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olr302 Protein Vector (Rat) (pPM-C-His)
PV289601 500 ng

Olr302 Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
GAGE10 Recombinant Protein (Human)
RP059898 100 µg

GAGE10 Recombinant Protein (Human)

Sign In for Pricing
View Details
Guinea pig Transmembrane 9 superfamily member 4 (TM9SF4) ELISA Kit
MBS7233674-01 48 Well

Guinea pig Transmembrane 9 superfamily member 4 (TM9SF4) ELISA Kit

Sign In for Pricing
View Details
Guinea pig Transmembrane 9 superfamily member 4 (TM9SF4) ELISA Kit
MBS7233674-02 96 Well

Guinea pig Transmembrane 9 superfamily member 4 (TM9SF4) ELISA Kit

Sign In for Pricing
View Details
Guinea pig Transmembrane 9 superfamily member 4 (TM9SF4) ELISA Kit
MBS7233674-03 5x 96 Well

Guinea pig Transmembrane 9 superfamily member 4 (TM9SF4) ELISA Kit

Sign In for Pricing
View Details
Guinea pig Transmembrane 9 superfamily member 4 (TM9SF4) ELISA Kit
MBS7233674-04 10x 96 Well

Guinea pig Transmembrane 9 superfamily member 4 (TM9SF4) ELISA Kit

Sign In for Pricing
View Details