Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPINT2 Rabbit Polyclonal Antibody (HRP)

SPINT2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

PB, Kop, HAI2, DIAR3, HAI-2

UniProt

O43291

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human SPINT2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MLRCFRQQENPPLPLGSKVVVLAGLFVMVLILFLGASMVYLIRVARRNQE

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

28kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Yeast

Tested Applications

WB

NCBI Accession Number

NP_066925

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2510003E04Rik sgRNA CRISPR Lentivector (Mouse) (Target 2)
K4088903 1.0 µg DNA

2510003E04Rik sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Recombinant Borrelia burgdorferi Uncharacterized protein BB_0019 (BB_0019)
MBS1029286-01 0.05 mg (E-Coli)

Recombinant Borrelia burgdorferi Uncharacterized protein BB_0019 (BB_0019)

Sign In for Pricing
View Details
Recombinant Borrelia burgdorferi Uncharacterized protein BB_0019 (BB_0019)
MBS1029286-02 0.2 mg (E-Coli)

Recombinant Borrelia burgdorferi Uncharacterized protein BB_0019 (BB_0019)

Sign In for Pricing
View Details
Recombinant Borrelia burgdorferi Uncharacterized protein BB_0019 (BB_0019)
MBS1029286-03 0.05 mg (Yeast)

Recombinant Borrelia burgdorferi Uncharacterized protein BB_0019 (BB_0019)

Sign In for Pricing
View Details
Recombinant Borrelia burgdorferi Uncharacterized protein BB_0019 (BB_0019)
MBS1029286-04 0.5 mg (E-Coli)

Recombinant Borrelia burgdorferi Uncharacterized protein BB_0019 (BB_0019)

Sign In for Pricing
View Details
Recombinant Borrelia burgdorferi Uncharacterized protein BB_0019 (BB_0019)
MBS1029286-05 0.05 mg (Baculovirus)

Recombinant Borrelia burgdorferi Uncharacterized protein BB_0019 (BB_0019)

Sign In for Pricing
View Details