Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ANGPTL7 Rabbit Polyclonal Antibody (Biotin)

ANGPTL7 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

AngX, CDT6, dJ647M16.1

UniProt

O43827

Immunogen

The immunogen for Anti-ANGPTL7 antibody is: synthetic peptide directed towards the N-terminal region of Human ANGL7

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: YSEMNNQIDIMQLQAAQTVTQTSADAIYDCSSLYQKNYRISGVYKLPPDD

Purification

Affinity purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

38 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_066969.1

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human P2RY2 Knockout HEK293T cell line
GTR15404018 1 Vial

Human P2RY2 Knockout HEK293T cell line

Sign In for Pricing
View Details
APOBEC3D/APOBEC3F polyclonal antibody
orb646256-01 50 μL

APOBEC3D/APOBEC3F polyclonal antibody

Sign In for Pricing
View Details
APOBEC3D/APOBEC3F polyclonal antibody
orb646256-02 100 µL

APOBEC3D/APOBEC3F polyclonal antibody

Sign In for Pricing
View Details
APOBEC3D/APOBEC3F polyclonal antibody
orb646256-03 200 µL

APOBEC3D/APOBEC3F polyclonal antibody

Sign In for Pricing
View Details
Recombinant Bacillus subtilis Putative oxidoreductase yetM (yetM)
MBS1100386-01 0.02 mg (E-Coli)

Recombinant Bacillus subtilis Putative oxidoreductase yetM (yetM)

Sign In for Pricing
View Details
Recombinant Bacillus subtilis Putative oxidoreductase yetM (yetM)
MBS1100386-02 0.02 mg (Yeast)

Recombinant Bacillus subtilis Putative oxidoreductase yetM (yetM)

Sign In for Pricing
View Details