Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ANGPTL7 Rabbit Polyclonal Antibody (FITC)

ANGPTL7 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

AngX, CDT6, dJ647M16.1

UniProt

O43827

Immunogen

The immunogen for Anti-ANGPTL7 antibody is: synthetic peptide directed towards the N-terminal region of Human ANGL7

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: YSEMNNQIDIMQLQAAQTVTQTSADAIYDCSSLYQKNYRISGVYKLPPDD

Purification

Affinity purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

38 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_066969.1

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PEA-15 (Ab-116) Antibody
8B0545-AAT 50 µg

PEA-15 (Ab-116) Antibody

Sign In for Pricing
View Details
P21WAF1 (Tumor Suppressor Protein) (AC8), CF568 conjugate, 0.1mg/mL
BNC682378-500 1x 500 µL

P21WAF1 (Tumor Suppressor Protein) (AC8), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
BAD (Ab-91/128) Antibody
8B0821-AAT 50 µg

BAD (Ab-91/128) Antibody

Sign In for Pricing
View Details
Nuclear Membrane (NM97), CF647 conjugate, 0.1mg/mL
BNC470097-100 1x 100 µL

Nuclear Membrane (NM97), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Mouse CD48 Antibody[HM48-1]
E-AB-F1017UM1-01 25 µg

Elab Fluor® 700 Anti-Mouse CD48 Antibody[HM48-1]

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Mouse CD48 Antibody[HM48-1]
E-AB-F1017UM1-02 100 µg

Elab Fluor® 700 Anti-Mouse CD48 Antibody[HM48-1]

Sign In for Pricing
View Details