Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZP4 Rabbit Polyclonal Antibody (HRP)

ZP4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ZBP, ZP1, ZPB, Zp-4

UniProt

Q12836

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ZP4

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MWLLRCVLLCVSLSLAVSGQHKPEAPDYSSVLHCGPWSFQFAVNLNQEAT

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

49kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_067009

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal BTK Antibody [mFluor Violet 610 SE]
NBP1-76596MFV610 0.1 mL

Rabbit Polyclonal BTK Antibody [mFluor Violet 610 SE]

Sign In for Pricing
View Details
IGFBP1 sgRNA CRISPR Lentivector (Human) (Target 1)
K1025302 1.0 µg DNA

IGFBP1 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
CFA/TBCA Rabbit Polyclonal Antibody (Fluoro647)
orb3101053 100 µg

CFA/TBCA Rabbit Polyclonal Antibody (Fluoro647)

Sign In for Pricing
View Details
Guinea pig Cysteine and histidine-rich domain-containing protein 1 (CHORDC1) ELISA Kit
MBS7227670-01 48 Well

Guinea pig Cysteine and histidine-rich domain-containing protein 1 (CHORDC1) ELISA Kit

Sign In for Pricing
View Details
Guinea pig Cysteine and histidine-rich domain-containing protein 1 (CHORDC1) ELISA Kit
MBS7227670-02 96 Well

Guinea pig Cysteine and histidine-rich domain-containing protein 1 (CHORDC1) ELISA Kit

Sign In for Pricing
View Details
Guinea pig Cysteine and histidine-rich domain-containing protein 1 (CHORDC1) ELISA Kit
MBS7227670-03 5x 96 Well

Guinea pig Cysteine and histidine-rich domain-containing protein 1 (CHORDC1) ELISA Kit

Sign In for Pricing
View Details