Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SRPRB Rabbit Polyclonal Antibody (FITC)

SRPRB Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

APMCF1, SR-beta

UniProt

Q9Y5M8

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human SRPRB

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: APAQLGKKGKEFEFSQLPLKVEFLECSAKGGRGDVGSADIQDLEKWLAKI

Field of Research

Cell Biology

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

30kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_067026

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human MHCG (Major Histocompatibility Complex Class I G) ELISA Kit
MBS2508713-01 24 Tests (Limit 1)

Human MHCG (Major Histocompatibility Complex Class I G) ELISA Kit

Sign In for Pricing
View Details
Human MHCG (Major Histocompatibility Complex Class I G) ELISA Kit
MBS2508713-02 48 Tests

Human MHCG (Major Histocompatibility Complex Class I G) ELISA Kit

Sign In for Pricing
View Details
Human MHCG (Major Histocompatibility Complex Class I G) ELISA Kit
MBS2508713-03 96 Tests

Human MHCG (Major Histocompatibility Complex Class I G) ELISA Kit

Sign In for Pricing
View Details
Human MHCG (Major Histocompatibility Complex Class I G) ELISA Kit
MBS2508713-04 5x 96 Tests

Human MHCG (Major Histocompatibility Complex Class I G) ELISA Kit

Sign In for Pricing
View Details
Human MHCG (Major Histocompatibility Complex Class I G) ELISA Kit
MBS2508713-05 10x 96 Tests

Human MHCG (Major Histocompatibility Complex Class I G) ELISA Kit

Sign In for Pricing
View Details
4E-BP1 Antibody
MBS8512439-01 0.05 mg

4E-BP1 Antibody

Sign In for Pricing
View Details