Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SRPRB Rabbit Polyclonal Antibody (HRP)

SRPRB Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

APMCF1, SR-beta

UniProt

Q9Y5M8

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human SRPRB

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: APAQLGKKGKEFEFSQLPLKVEFLECSAKGGRGDVGSADIQDLEKWLAKI

Field of Research

Cell Biology

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

30kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_067026

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human BLM siRNA
abx909137-01 15 nmol

Human BLM siRNA

Sign In for Pricing
View Details
Human BLM siRNA
abx909137-02 30 nmol

Human BLM siRNA

Sign In for Pricing
View Details
CD4 (CD4 Receptor, CD4mut, T Cell Surface Antigen T4/Leu3, T Cell Surface Glycoprotein CD4) (Azide Free) discontinued
C2255-29A 1 mg

CD4 (CD4 Receptor, CD4mut, T Cell Surface Antigen T4/Leu3, T Cell Surface Glycoprotein CD4) (Azide Free) discontinued

Sign In for Pricing
View Details
W/W048/NT/PP-TRI100-1 Marine & IMO Signs (No Adhesive)
300842 1 Pack (1 Panel (s) x 1 Pack)

W/W048/NT/PP-TRI100-1 Marine & IMO Signs (No Adhesive)

Sign In for Pricing
View Details
Anti-Hu Tenascin C Purified
11-370-C025 0.025 mg

Anti-Hu Tenascin C Purified

Sign In for Pricing
View Details
ALDH4A1 Antibody
A73460-100UL 100 µL

ALDH4A1 Antibody

Sign In for Pricing
View Details