Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CDH22 Rabbit Polyclonal Antibody (HRP)

CDH22 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

C20orf25, dJ998H6.1

UniProt

Q61751

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LIDELTGDIHAMERLDREQKTFYTLRAQARDRATNRLLEPESEFIIKVQD

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

73kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_033355

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC2A13 Rabbit pAb, Pacific Blue conjugated
orb2886903 100 µL

SLC2A13 Rabbit pAb, Pacific Blue conjugated

Sign In for Pricing
View Details
AKT1S1 Rabbit Monoclonal Antibody
E49Y7054 100 µL

AKT1S1 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Human recombinant ATP1B2 protein
PROTP14415-4-10ug 10 µg

Human recombinant ATP1B2 protein

Sign In for Pricing
View Details
Human Upstream stimulatory factor 2, USF2 ELISA KIT
E7611Hu-01 48 Well

Human Upstream stimulatory factor 2, USF2 ELISA KIT

Sign In for Pricing
View Details
Human Upstream stimulatory factor 2, USF2 ELISA KIT
E7611Hu-02 96 Well

Human Upstream stimulatory factor 2, USF2 ELISA KIT

Sign In for Pricing
View Details
Human Upstream stimulatory factor 2, USF2 ELISA KIT
E7611Hu-03 5x 96 Tests

Human Upstream stimulatory factor 2, USF2 ELISA KIT

Sign In for Pricing
View Details