Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CDH22 Rabbit Polyclonal Antibody (Biotin)

CDH22 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

C20orf25, dJ998H6.1

UniProt

Q9UJ99

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human CDH22

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LIDELTGDIHAMERLDREQKTFYTLRAQARDRATNRLLEPESEFIIKVQD

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

73kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

EAW75754

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KLHL4 (Kelch-like Protein 4, KIAA1687, DKELCHL) (Biotin)
MBS6383698-01 0.1 mL

KLHL4 (Kelch-like Protein 4, KIAA1687, DKELCHL) (Biotin)

Sign In for Pricing
View Details
KLHL4 (Kelch-like Protein 4, KIAA1687, DKELCHL) (Biotin)
MBS6383698-02 5x 0.1 mL

KLHL4 (Kelch-like Protein 4, KIAA1687, DKELCHL) (Biotin)

Sign In for Pricing
View Details
SEMA3F Rabbit Polyclonal Antibody
orb3128134 100 µg

SEMA3F Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
DMT-locMeC (bz) phosphoramidite
orb1907738 5 mg

DMT-locMeC (bz) phosphoramidite

Sign In for Pricing
View Details
Recombinant Rabies virus Glycoprotein G (G)
MBS7039497-01 0.02 mg

Recombinant Rabies virus Glycoprotein G (G)

Sign In for Pricing
View Details
Recombinant Rabies virus Glycoprotein G (G)
MBS7039497-02 0.1 mg

Recombinant Rabies virus Glycoprotein G (G)

Sign In for Pricing
View Details