Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CDH22 Rabbit Polyclonal Antibody (HRP)

CDH22 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

C20orf25, dJ998H6.1

UniProt

Q9UJ99

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human CDH22

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LIDELTGDIHAMERLDREQKTFYTLRAQARDRATNRLLEPESEFIIKVQD

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

73kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

EAW75754

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lamin A/C Recombinant Rabbit mAb, BF350 conjugated
orb3163418 100 µL

Lamin A/C Recombinant Rabbit mAb, BF350 conjugated

Sign In for Pricing
View Details
1-Ethynyl-1- (triisopropylsilyloxy) cyclopropane
011838 2.5 mg

1-Ethynyl-1- (triisopropylsilyloxy) cyclopropane

Sign In for Pricing
View Details
VAC14 (Biotin)
581047-01 50 µg

VAC14 (Biotin)

Sign In for Pricing
View Details
VAC14 (Biotin)
581047-02 100 µg

VAC14 (Biotin)

Sign In for Pricing
View Details
DNA pol α CRISPR/Cas9 KO Plasmid (m)
sc-422334 20 µg

DNA pol α CRISPR/Cas9 KO Plasmid (m)

Sign In for Pricing
View Details
Mouse Stn1 activation kit by CRISPRa
GA212130 1 Kit

Mouse Stn1 activation kit by CRISPRa

Sign In for Pricing
View Details