Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL22RA1 Rabbit Polyclonal Antibody (Biotin)

IL22RA1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

IL22R, CRF2-9, IL22R1

UniProt

Q8N6P7

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human IL22RA1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: DQGPSPWGLLESLVCPKDEAKSPAPETSDLEQPTELDSLFRGLALTVQWE

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

63kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_067081

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Polyclonal Antibody to GATA Binding Protein 3 (GATA3)
TRV-0053565-01 20 µL

Polyclonal Antibody to GATA Binding Protein 3 (GATA3)

Sign In for Pricing
View Details
Polyclonal Antibody to GATA Binding Protein 3 (GATA3)
TRV-0053565-02 100 µL

Polyclonal Antibody to GATA Binding Protein 3 (GATA3)

Sign In for Pricing
View Details
Polyclonal Antibody to GATA Binding Protein 3 (GATA3)
TRV-0053565-03 200 µL

Polyclonal Antibody to GATA Binding Protein 3 (GATA3)

Sign In for Pricing
View Details
Polyclonal Antibody to GATA Binding Protein 3 (GATA3)
TRV-0053565-04 1 mL

Polyclonal Antibody to GATA Binding Protein 3 (GATA3)

Sign In for Pricing
View Details
Osajin 5mg
A22540-5 5 mg

Osajin 5mg

Sign In for Pricing
View Details
S-Carbonyl Reductase (Crude Enzyme, for NADH Regeneration)
P3514-1L 1 L

S-Carbonyl Reductase (Crude Enzyme, for NADH Regeneration)

Sign In for Pricing
View Details